PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HZI51
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family LBD
Protein Properties Length: 209aa    MW: 23216 Da    PI: 4.6549
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HZI51genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-42361351100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++C+lapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++
  Aradu.HZI51  36 PCAACKILRRRCTEKCMLAPYFPPTEPTKFTIAHRVFGASNIVKFLQEIPESQRADAVSSMVYEASARIRDPVYGCAGAICQLQKQVNELRAQLAKTQ 133
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Aradu.HZI51 134 AE 135
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01135136IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEGSDTNNTT YSNSTSTSSG DPPPPAAATV AVVMSPCAAC KILRRRCTEK CMLAPYFPPT  60
EPTKFTIAHR VFGASNIVKF LQEIPESQRA DAVSSMVYEA SARIRDPVYG CAGAICQLQK  120
QVNELRAQLA KTQAEVATMQ FQQANLVALI YMEMAQQQSS QQQQQEFESS PQQSSMEDFN  180
VPSPHYQQSN INYFEDNPSL NSLWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015952606.11e-155PREDICTED: LOB domain-containing protein 1
SwissprotQ9LQR05e-77LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK082e-76LBD11_ARATH; LOB domain-containing protein 11
TrEMBLK7M3861e-95K7M386_SOYBN; Uncharacterized protein
STRINGGLYMA13G40370.24e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.14e-72LOB domain-containing protein 11